AibGenesis™ Mouse Anti-CCDC103 Antibody (CBMOAB-38282FYA)


Cat: CBMOAB-38282FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38282FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38282FYA 100 µg
CBMOAB-69284FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69284FYA 100 µg
MO-AB-16716W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16716W 100 µg
MO-AB-24541H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24541C 100 µg
MO-AB-52355W Monoclonal Marmoset WB, ELISA MO52355W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38282FYA
SpecificityThis antibody binds to Rhesus CCDC103.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that contains a coiled-coil domain. (From NCBI)
Product OverviewMouse Anti-Rhesus CCDC103 Antibody is a mouse antibody against CCDC103. It can be used for CCDC103 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 103; CCDC103
UniProt IDH9F2L3
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: YQTLLQLGGPKLGRLFQTDVGFGLLGELLVALADHVGPADRAGVLGILRSLASTGRFTLNLSLLSQAERESCKGLFQKLQAMGVPGSMKEGLSWEEQGLEEQSGGLQEEERLLQELLELYQVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry