AibGenesis™ Mouse Anti-CCDC106 Antibody (CBMOAB-38284FYA)


Cat: CBMOAB-38284FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38284FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO38284FYA 100 µg
MO-AB-09597R Monoclonal Cattle (Bos taurus) WB, ELISA MO09597R 100 µg
MO-AB-20743W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20743W 100 µg
MO-AB-52359W Monoclonal Marmoset WB, ELISA MO52359W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO38284FYA
SpecificityThis antibody binds to Rhesus CCDC106.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCDC106 (Coiled-Coil Domain Containing 106) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CCDC106 Antibody is a mouse antibody against CCDC106. It can be used for CCDC106 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC106
UniProt IDF6RZU5
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MNDRSSRRRTMKDDETFEISIPFDEAPHLDSQIFYSLSPSRGNFEEPPEAASPALALMNSVKAQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQRGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFKHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR.
For Research Use Only | Not For Clinical Use.
Online Inquiry