AibGenesis™ Mouse Anti-CCDC114 Antibody (CBMOAB-38295FYA)


Cat: CBMOAB-38295FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38295FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38295FYA 100 µg
CBMOAB-69293FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69293FYA 100 µg
MO-AB-52365W Monoclonal Marmoset WB, ELISA MO52365W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO38295FYA
SpecificityThis antibody binds to Rhesus CCDC114.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a coiled-coil domain-containing protein that is a component of the outer dynein arm docking complex in cilia cells. Mutations in this gene may cause primary ciliary dyskinesia 20. (From NCBI)
Product OverviewMouse Anti-Rhesus CCDC114 Antibody is a mouse antibody against CCDC114. It can be used for CCDC114 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC114
UniProt IDF6QHT7
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: MSIPTGAPPSLARMPLGRLSGSARSEEGSEAFLEGMVDWELSRLQRQCKVMEGERRAYSKEVHQRINKQLEEIRRLEEVRGNLQVQISAAQNQVKRLRDSERLENMDRLLKGRAQVQAEIEELQEQTRALDKQIQEWETRIFTHSKNVRSSGFVLDQKVKIGRRIRILEDQLDRVICHFDNQLVRNAALREELDLLRIDRNRYLNMDRKLKKEIHHLRHLVSSLILSSTSAYAVREEAKAKMGLLRERAEKEEAQSETEAQVLQRQISHLEQLHRFLKLKNNDRQPDSDVLEKREKQAREVAEGVRKTSQERLVLRYEDALNKLSQLMGESDPDLLVQKYLESE.
For Research Use Only | Not For Clinical Use.
Online Inquiry