AibGenesis™ Mouse Anti-CCDC123 Antibody (CBMOAB-38305FYA)


Cat: CBMOAB-38305FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38305FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38305FYA 100 µg
MO-AB-09606R Monoclonal Cattle (Bos taurus) WB, ELISA MO09606R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38305FYA
SpecificityThis antibody binds to Rhesus CCDC123.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC123 Antibody is a mouse antibody against CCDC123. It can be used for CCDC123 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCentrosomal protein of 89 kDa; CCDC123
UniProt IDH9FCU1
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: RSESDVSSVEQDSFIEPYATTSELRLRPNWQSEMGRRSSLPSFETLGCEEEEDIETQLSSSCKELGDVSAQEDKGGHGDDLYAVPHRNQVPLLHEVDSEDDENVSDQDEFPGSPPTPQRIQQKDGKYSVLNLKDEKPPLREKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry