AibGenesis™ Mouse Anti-CCDC153 Antibody (CBMOAB-38363FYA)


Cat: CBMOAB-38363FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38363FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38363FYA 100 µg
CBMOAB-69337FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69337FYA 100 µg
MO-AB-09619R Monoclonal Cattle (Bos taurus) WB, ELISA MO09619R 100 µg
MO-AB-24549H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24549C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38363FYA
SpecificityThis antibody binds to Rhesus CCDC153.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC153 Antibody is a mouse antibody against CCDC153. It can be used for CCDC153 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC153
UniProt IDF7HTM5
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: MSRQCHALQEDMQSRSKQLEEEVKGLRGQLEACQREAAAAREEAEQALRERDQALSQLRTHVADMEAKYEEILQDSLDRLLAKLRAIKSQWDGTALRLHARHKEQLRQFGLTPGSLRPSAPSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry