AibGenesis™ Mouse Anti-CCDC28A Antibody (CBMOAB-38406FYA)


Cat: CBMOAB-38406FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38406FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38406FYA 100 µg
CBMOAB-69376FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69376FYA 100 µg
MO-AB-21772W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21772W 100 µg
MO-AB-24559H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24559C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38406FYA
SpecificityThis antibody binds to Rhesus CCDC28A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC28A Antibody is a mouse antibody against CCDC28A. It can be used for CCDC28A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC28A
UniProt IDF6UIK2
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: MPRAETRVTLGEQEKAGLPLGAWRPCLRHFRKQRQLPRRGSRDVTGAVFVAAAVASEAVGSLRVAEGGPNTLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPKLKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDVSHIHMSQQKLHLADAQDVPNTSAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry