Mouse Anti-Rhesus CCKBR Antibody (CBMOAB-38535FYA)


Cat: CBMOAB-38535FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38535FYA
SpecificityThis antibody binds to Rhesus CCKBR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCKBR (Cholecystokinin B Receptor) is a Protein Coding gene. Diseases associated with CCKBR include Panic Disorder and Pancreatic Cancer. Among its related pathways are Salivary secretion and Cell-type Dependent Selectivity of CCK2R Signaling. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and 1-phosphatidylinositol-3-kinase regulator activity. An important paralog of this gene is CCKAR.
Product OverviewMouse Anti-Rhesus CCKBR Antibody is a mouse antibody against CCKBR. It can be used for CCKBR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGastrin/cholecystokinin type B receptor; CCKBR
UniProt IDH9EZH6
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MELLKLNRSVQGTGPGPGASLCRPAAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYFMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSGSQSRVRSQGRLPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry