AibGenesis™ Mouse Anti-CCNO Antibody (CBMOAB-38578FYA)


Cat: CBMOAB-38578FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38578FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO38578FYA 100 µg
MO-AB-24599H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24599C 100 µg
MO-AB-52485W Monoclonal Marmoset WB, ELISA MO52485W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO38578FYA
SpecificityThis antibody binds to Rhesus CCNO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCNO Antibody is a mouse antibody against CCNO. It can be used for CCNO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCNO
UniProt IDF6QZI4
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: NPSLSFELLSALREVMCTTLSGTGPNPGVPAQAHAFPSFHCVSSEILLPLSGEAPRFFLALPSLPQPLHPKPSGPPPSPSRQVTAESRCKLLSWLIPVHRQFGLSFESLCLTVNTLDRFLTTTPVQTASSCSGSPPCSSLANRWRCTRRAKQLLALCCGAFSRQQLCNLECIVLHKLHFRLGAPTISFFLEHFTQARVESPKLWKRKPWRGVAELSLADYAFTSYSPSLLAICCLALADRMLRAARGLAPGRPPGGGAGGLPGQAAAAGGHKQYFLDSHAARSDLREVQPAPELEIKQTLGFLLVPDPAAGPLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry