Mouse Anti-Rhesus CD1A Antibody (CBMOAB-38637FYA)


Cat: CBMOAB-38637FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38637FYA
SpecificityThis antibody binds to Rhesus CD1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD1A (CD1a Molecule) is a Protein Coding gene. Diseases associated with CD1A include Langerhans Cell Histiocytosis and Histiocytosis. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include beta-2-microglobulin binding and endogenous lipid antigen binding. An important paralog of this gene is CD1B.
Product OverviewMouse Anti-Rhesus CD1A Antibody is a mouse antibody against CD1A. It can be used for CD1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD1a; CD1A
UniProt IDB9X0T4
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MLFLLLPLLAVLPGGGNADGLKEPVSFHVIRISSFNNHSWKRNLVSGYLGHLQTHTSDRNCSTIIFLWPWSRGNFSNKEWKELEMLLHICCVRFLEGMRRYSRELQFEYPFEIQVTGGCELHSGKFSGSFLRLAYQGSDFMSFQNNSWLPSPVAGNMAKRLCKVINRNQHQNDIIHSLLSDTCPRLILGLLDAGKAHLQRQVKPEAWLSRGLSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPNADGTWYLRATQEVAAGEAADLSCRVKHSSLEGQDIILYWEHHSSMGLIILAVIVPLLLLIGLALWFRKRCFR.
See other products for " CD1A "
For Research Use Only | Not For Clinical Use.
Online Inquiry