Mouse Anti-Rhesus CD40L Antibody (CBMOAB-38709FYA)
Cat: CBMOAB-38709FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO38709FYA |
| Specificity | This antibody binds to Rhesus CD40L. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Involved in immunoglobulin class switching. |
| Product Overview | Mouse Anti-Rhesus CD40L Antibody is a mouse antibody against CD40L. It can be used for CD40L detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD40 ligand; CD40L |
| UniProt ID | A9XA63 |
| Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: MIETYNQPSPRSAATGLPVRMKIFMYLLTIFLITQMIGSALFAVYLHRRLDK. |
See other products for " CD40L "
| MO-AB-10840Y | Mouse Anti-O. mykiss CD40L Antibody (MO-AB-10840Y) |
| MO-AB-24463R | Mouse Anti-Pig CD40L Antibody (MO-AB-24463R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry