Mouse Anti-Rhesus CD5 Antibody (CBMOAB-38725FYA)


Cat: CBMOAB-38725FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details
  • Relate Reference Data

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38725FYA
SpecificityThis antibody binds to Rhesus CD5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD5 (CD5 Molecule) is a Protein Coding gene. Diseases associated with CD5 include Thymus Cancer and Richter's Syndrome. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and B Cell Development Pathways. Gene Ontology (GO) annotations related to this gene include receptor activity and scavenger receptor activity.
Product OverviewMouse Anti-Rhesus CD5 Antibody is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD5; CD5
UniProt IDH9ZFB2
Protein RefseqThe length of the protein is 499 amino acids long.
The sequence is show below: MPMRSPQPLATLYLLGMLVASCLGRLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFRKIKPRNSGQVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCQEQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNPAGPAAGTVASIILALVLLGVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHVENPTASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLHGAQRL.

Reference

ReferenceMakori, N., Tarantal, A. F., Lü, F. X., Rourke, T., Marthas, M. L., McChesney, M. B., ... & Miller, C. J. (2003). Functional and morphological development of lymphoid tissues and immune regulatory and effector function in Rhesus monkeys: Cytokine-secreting cells, immunoglobulin-secreting cells, and CD5+ B-1 cells appear early in fetal development. Clinical and Vaccine Immunology, 10(1), 140-153.

Figure 1 Fetal CD20+ B cells express CD5. Double immunofluorescence with and anti-CD5 (FITC green) in the spleen.

For Research Use Only | Not For Clinical Use.
Online Inquiry