AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-38725FYA)
Cat: CBMOAB-38725FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38725FYA | Monoclonal | Rhesus (Macaca mulatta), Alpaca (Vicugna pacos), Llama (camel), Cattle (Bos taurus), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO38725FYA | 100 µg | ||
| CBMOAB-00040FYA | Monoclonal | Cattle (Bos taurus) | FC | F00040FYA | 100 µg | ||
| CBMOAB-00041FYA | Monoclonal | Cattle (Bos taurus) | FC | F00041FYA | 100 µg | ||
| CBMOAB-00042FYA | Monoclonal | Cattle (Bos taurus) | FC | F00042FYA | 100 µg | ||
| CBMOAB-00134FYA | Monoclonal | Dog (Canis lupus familiaris) | FC | F00134FYA | 100 µg | ||
| CBMOAB-00140FYA | Monoclonal | Goat (Capra hircus) | FC | F00140FYA | 100 µg | ||
| CBMOAB-00179FYA | Monoclonal | Rabbit (Oryctolagus cuniculus) | FC | F00179FYA | 100 µg | ||
| CBMOAB-00198FYA | Monoclonal | Pig (Sus scrofa) | FC | F00198FYA | 100 µg | ||
| CBMOAB-00219FYA | Monoclonal | Alpaca (Vicugna pacos), Llama (camel) | FC | F00219FYA | 100 µg | ||
| MO-AB-14505Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14505Y | 100 µg | ||
| MOFY-0522-FY49 | Monoclonal | Human, Rhesus, Cynomolgus, Chimpanzee | FC, IHC, WB, IP | 100 µg | |||
| MOFY-0522-FY69 | Monoclonal | Feline, Lion | FC, IHC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Alpaca (Vicugna pacos), Llama (camel), Cattle (Bos taurus), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO38725FYA |
| Specificity | This antibody binds to Rhesus CD5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus CD5 Antibody is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | T-cell surface glycoprotein CD5; CD5 |
| UniProt ID | H9ZFB2 |
| Protein Refseq | The length of the protein is 499 amino acids long. The sequence is show below: MPMRSPQPLATLYLLGMLVASCLGRLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFRKIKPRNSGQVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCQEQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNPAGPAAGTVASIILALVLLGVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHVENPTASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLHGAQRL. |
Reference
| Reference | Makori, N., Tarantal, A. F., Lü, F. X., Rourke, T., Marthas, M. L., McChesney, M. B., ... & Miller, C. J. (2003). Functional and morphological development of lymphoid tissues and immune regulatory and effector function in Rhesus monkeys: Cytokine-secreting cells, immunoglobulin-secreting cells, and CD5+ B-1 cells appear early in fetal development. Clinical and Vaccine Immunology, 10(1), 140-153. |
See other products for " CD5 "
| MO-AB-09869R | AibGenesis™ Mouse Anti-CD5 Antibody (MO-AB-09869R) |
| CBMOAB-00147FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00147FYA) |
| CBMOAB-00148FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00148FYA) |
| CBMOAB-00168FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00168FYA) |
| CBMOAB-00133FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00133FYA) |
| MO-AB-01065Y | AibGenesis™ Mouse Anti-CD5 Antibody (MO-AB-01065Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry