AibGenesis™ Mouse Anti-CD5 Antibody (MO-AB-09869R)
Cat: MO-AB-09869R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09869R | Monoclonal | Cattle (Bos taurus), Alpaca (Vicugna pacos), Llama (camel), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO09869R | 100 µg | ||
| CBMOAB-00040FYA | Monoclonal | Cattle (Bos taurus) | FC | F00040FYA | 100 µg | ||
| CBMOAB-00041FYA | Monoclonal | Cattle (Bos taurus) | FC | F00041FYA | 100 µg | ||
| CBMOAB-00042FYA | Monoclonal | Cattle (Bos taurus) | FC | F00042FYA | 100 µg | ||
| CBMOAB-00134FYA | Monoclonal | Dog (Canis lupus familiaris) | FC | F00134FYA | 100 µg | ||
| CBMOAB-00140FYA | Monoclonal | Goat (Capra hircus) | FC | F00140FYA | 100 µg | ||
| CBMOAB-00179FYA | Monoclonal | Rabbit (Oryctolagus cuniculus) | FC | F00179FYA | 100 µg | ||
| CBMOAB-00198FYA | Monoclonal | Pig (Sus scrofa) | FC | F00198FYA | 100 µg | ||
| CBMOAB-00219FYA | Monoclonal | Alpaca (Vicugna pacos), Llama (camel) | FC | F00219FYA | 100 µg | ||
| MO-AB-14505Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14505Y | 100 µg | ||
| MOFY-0522-FY49 | Monoclonal | Human, Rhesus, Cynomolgus, Chimpanzee | FC, IHC, WB, IP | 100 µg | |||
| MOFY-0522-FY69 | Monoclonal | Feline, Lion | FC, IHC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Alpaca (Vicugna pacos), Llama (camel), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO09869R |
| Specificity | This antibody binds to Cattle CD5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Cattle CD5 Antibody is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | T-cell surface glycoprotein CD5; CD antigen CD5; CD5 |
| UniProt ID | P19238 |
| Protein Refseq | The length of the protein is 495 amino acids long. The sequence is show below: MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSNGTEWYAVHSQSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSNCSLNRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSGGLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNPKCTSLEQCFRKVQPW. |
Reference
| Reference | 1. Cantor, G. H., Pritchard, S. M., Dequiedt, F., Willems, L., Kettmann, R., & Davis, W. C. (2001). CD5 is dissociated from the B-cell receptor in B cells from bovine leukemia virus-infected, persistently lymphocytotic cattle: consequences to B-cell receptor-mediated apoptosis. Journal of Virology, 75(4), 1689-1696. 2. Stabel, J. R., & Khalifeh, M. S. (2008). Differential expression of CD5 on B lymphocytes in cattle infected with Mycobacterium avium subsp. paratuberculosis. Veterinary immunology and immunopathology, 126(3-4), 211-219. 3. Morrison, W. I., Howard, C. J., & Hinson, C. A. (1991). Polymorphism of the CD4 and CD5 differentiation antigens in cattle. Veterinary immunology and immunopathology, 27(1-3), 235-238. |
See other products for " CD5 "
| CBMOAB-00147FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00147FYA) |
| CBMOAB-00148FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00148FYA) |
| MO-AB-01065Y | AibGenesis™ Mouse Anti-CD5 Antibody (MO-AB-01065Y) |
| CBMOAB-00133FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00133FYA) |
| CBMOAB-38725FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-38725FYA) |
| CBMOAB-00168FYA | AibGenesis™ Mouse Anti-CD5 Antibody (CBMOAB-00168FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry