Mouse Anti-CD5 Antibody (MO-AB-09869R)


Cat: MO-AB-09869R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09869R Monoclonal Cattle (Bos taurus), Alpaca (Vicugna pacos), Llama (camel), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO09869R 100 µg
CBMOAB-00040FYA Monoclonal Cattle (Bos taurus) FC F00040FYA 100 µg
CBMOAB-00041FYA Monoclonal Cattle (Bos taurus) FC F00041FYA 100 µg
CBMOAB-00042FYA Monoclonal Cattle (Bos taurus) FC F00042FYA 100 µg
CBMOAB-00134FYA Monoclonal Dog (Canis lupus familiaris) FC F00134FYA 100 µg
CBMOAB-00140FYA Monoclonal Goat (Capra hircus) FC F00140FYA 100 µg
CBMOAB-00179FYA Monoclonal Rabbit (Oryctolagus cuniculus) FC F00179FYA 100 µg
CBMOAB-00198FYA Monoclonal Pig (Sus scrofa) FC F00198FYA 100 µg
CBMOAB-00219FYA Monoclonal Alpaca (Vicugna pacos), Llama (camel) FC F00219FYA 100 µg
MO-AB-14505Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14505Y 100 µg
MOFY-0522-FY49 Monoclonal Human, Rhesus, Cynomolgus, Chimpanzee FC, IHC, WB, IP 100 µg
MOFY-0522-FY69 Monoclonal Feline, Lion FC, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Alpaca (Vicugna pacos), Llama (camel), Dog (Canis lupus familiaris), Feline, Lion, Goat (Capra hircus), Human, Rhesus, Cynomolgus, Chimpanzee, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO09869R
SpecificityThis antibody binds to Cattle CD5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAs with human CD5+ B cells, we report here that CD5 is physically associated with the B cell receptor (BCR) in normal bovine CD5+ B cells. In contrast, in CD5+ B cells from BLV-infected PL cattle, CD5 was dissociated from the BCR. In B cells from PL cattle, apoptosis was reduced when cells were stimulated with surface immunoglobulin M (sIgM) antibodies, whereas in B cells from uninfected cattle, apoptosis was increased after sIgM stimulation.
Product OverviewMouse Anti-Cattle CD5 Antibody is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD5; CD antigen CD5; CD5
UniProt IDP19238
Protein RefseqThe length of the protein is 495 amino acids long.
The sequence is show below: MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSNGTEWYAVHSQSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSNCSLNRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSGGLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNPKCTSLEQCFRKVQPW.

Reference

Reference1. Cantor, G. H., Pritchard, S. M., Dequiedt, F., Willems, L., Kettmann, R., & Davis, W. C. (2001). CD5 is dissociated from the B-cell receptor in B cells from bovine leukemia virus-infected, persistently lymphocytotic cattle: consequences to B-cell receptor-mediated apoptosis. Journal of Virology, 75(4), 1689-1696.
2. Stabel, J. R., & Khalifeh, M. S. (2008). Differential expression of CD5 on B lymphocytes in cattle infected with Mycobacterium avium subsp. paratuberculosis. Veterinary immunology and immunopathology, 126(3-4), 211-219.
3. Morrison, W. I., Howard, C. J., & Hinson, C. A. (1991). Polymorphism of the CD4 and CD5 differentiation antigens in cattle. Veterinary immunology and immunopathology, 27(1-3), 235-238.

Relate Reference Data

Figure 1 CD5 coimmunoprecipitates with the BCR in uninfected animals. B cells were enriched from PBMCs by T-cell depletion. Lanes 1 to 3, biotin-labeled cells in 1% digitonin lysis buffer were immunoprecipitated (IP) with either MAb to CD79a (the Ig-alpha component of the BCR) or isotype control MAb AV64A. Precipitates were resuspended in 1% NP-40 lysis buffer, and a second immunoprecipitation was performed using MAb to CD5 (MUCIA) or isotype control MAb. As a control, CD5 was immunoprecipitated directly from the PBMC NP-40 lysate using MAb to CD5 (lane 4).

For Research Use Only | Not For Clinical Use.
Online Inquiry