Mouse Anti-Rhesus CEBPA Antibody (CBMOAB-38909FYA)
Cat: CBMOAB-38909FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO38909FYA |
| Specificity | This antibody binds to Rhesus CEBPA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. |
| Product Overview | Mouse Anti-Rhesus CEBPA Antibody is a mouse antibody against CEBPA. It can be used for CEBPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CCAAT/enhancer-binding protein alpha; CEBPA |
| UniProt ID | H9F9V9 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: TGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA. |
See other products for " cebpa "
| CBMOAB-69983FYA | Mouse Anti-Zebrafish cebpa Antibody (CBMOAB-69983FYA) |
| MO-AB-52764W | Mouse Anti-Marmoset CEBPA Antibody (MO-AB-52764W) |
| MO-AB-10030R | Mouse Anti-Cattle CEBPA Antibody (MO-AB-10030R) |
| MO-AB-02304H | Mouse Anti-Frog cebpa Antibody (MO-AB-02304H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry