Mouse Anti-Rhesus CGB8 Antibody (CBMOAB-39105FYA)


Cat: CBMOAB-39105FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO39105FYA
SpecificityThis antibody binds to Rhesus CGB8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the glycoprotein hormone beta chain family and encodes the beta 8 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene.
Product OverviewMouse Anti-Rhesus CGB8 Antibody is a mouse antibody against CGB8. It can be used for CGB8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCGB8
UniProt IDF6ZG96
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MEMLQGLLLWLLLSMGGARASREPLRPLCRPINATLAAEKEACPVCITVNTTICAGYCPTMMRVLQVILPPVPQVVCNYREVRFESIRLPGCPPGVDPVVSVPVALSCRCALCRRSTSDCGGPKDHPLTCDDPHLQASSSSKDPPPSPPSPSRLLEPADTPFLPQ.
See other products for " CGB8 "
MO-AB-16364WMouse Anti-Chimpanzee CGB8 Antibody (MO-AB-16364W)
For Research Use Only | Not For Clinical Use.
Online Inquiry