AibGenesis™ Mouse Anti-CHAC2 Antibody (CBMOAB-39118FYA)


Cat: CBMOAB-39118FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39118FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39118FYA 100 µg
CBMOAB-70277FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70277FYA 100 µg
MO-AB-10132R Monoclonal Cattle (Bos taurus) WB, ELISA MO10132R 100 µg
MO-AB-24753H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24753C 100 µg
MO-AB-26641W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26641W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39118FYA
SpecificityThis antibody binds to Rhesus CHAC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. (From NCBI)
Product OverviewMouse Anti-Rhesus CHAC2 Antibody is a mouse antibody against CHAC2. It can be used for CHAC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCation transport regulator-like protein 2; CHAC2
UniProt IDH9F1I3
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEDEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry