AibGenesis™ Mouse Anti-CHTF8 Antibody (CBMOAB-39260FYA)


Cat: CBMOAB-39260FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39260FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39260FYA 100 µg
CBMOAB-70524FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70524FYA 100 µg
MO-AB-10234R Monoclonal Cattle (Bos taurus) WB, ELISA MO10234R 100 µg
MO-AB-19063W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19063W 100 µg
MO-AB-24607R Monoclonal Pig (Sus scrofa) WB, ELISA MO24607R 100 µg
MO-AB-24786H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24786C 100 µg
MO-AB-53019W Monoclonal Marmoset WB, ELISA MO53019W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39260FYA
SpecificityThis antibody binds to Rhesus CHTF8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternatively spliced transcript variants have been described. This gene has a pseudogene on chromosome X. (From NCBI)
Product OverviewMouse Anti-Rhesus CHTF8 Antibody is a mouse antibody against CHTF8. It can be used for CHTF8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHTF8
UniProt IDF7GLN6
Protein RefseqThe length of the protein is 522 amino acids long.
The sequence is show below: MKEPRIFPRERPTPWTRAPLPPRGRLDSSLGPQGGPVLNTGHPLGVNSDPFLMAAGSLGGNLAPFPRNPSPFPASSGSLASNPAPFPAGARDPSMASFPRGMNPTGTGAVSFPRPGGLLGPGPGPTLNPRTGALPGPGPLSNPRLGGLPGPGPMSNPRAGGLLGAGPDPRSGGPIGPGSGPNLRAGVLLTSGNGPPNPRPVGLGPGPNPNLRSGFLGTNPAPRSGVFPGPGLGPNPRPSGLGPGPNLDARAGGLLGTGSGLNLRMAGPQGLDLAPILRAAGLLGANSASFSQASGNMGTSPSSMARVPGPMGPNSGPGSRGIGLPGPNPSPMSRAPGPIGPNSAHFSRPGGPMGVNANSFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRATGLQGPSPTTFPRSTGPLGPGQVTFPRPAAGHLGPSPVGPVGINPAPFARPTGTLSLNPASFPRMNGPAGKSFVPFPRVGSLPGTNPAAFPRPGGPMATMYPNGMLPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry