Mouse Anti-Rhesus CIDEC Antibody (CBMOAB-39275FYA)
Cat: CBMOAB-39275FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO39275FYA |
| Specificity | This antibody binds to Rhesus CIDEC. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. |
| Product Overview | Mouse Anti-Rhesus CIDEC Antibody is a mouse antibody against CIDEC. It can be used for CIDEC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CIDEC |
| UniProt ID | F7GW95 |
| Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: VKATFYDTYSLSYDLHCCGAKRIVNARRLMESKQLWSVNRKGQPLMRLGWGGKIPNSKGA. |
See other products for " cidec "
| MO-AB-02413H | Mouse Anti-Frog cidec Antibody (MO-AB-02413H) |
| MO-AB-24798H | Mouse Anti-Rat Cidec Antibody (MO-AB-24798H) |
| MO-AB-10248R | Mouse Anti-Cattle CIDEC Antibody (MO-AB-10248R) |
| MO-AB-22775W | Mouse Anti-Chimpanzee CIDEC Antibody (MO-AB-22775W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry