AibGenesis™ Mouse Anti-CISD3 Antibody (CBMOAB-39289FYA)


Cat: CBMOAB-39289FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39289FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO39289FYA 100 µg
MO-AB-22617W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22617W 100 µg
MO-AB-24804H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24804C 100 µg
MO-AB-53047W Monoclonal Marmoset WB, ELISA MO53047W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO39289FYA
SpecificityThis antibody binds to Rhesus CISD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CISD3 Antibody is a mouse antibody against CISD3. It can be used for CISD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCDGSH iron-sulfur domain-containing protein 3, mitochondrial; CISD3
UniProt IDI2CY81
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MRCVGAILRPAAHGAWDLNPRRDISSWLARWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRTVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry