Mouse Anti-Rhesus CKM Antibody (MO-AB-03526W)


Cat: MO-AB-03526W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03526W
SpecificityThis antibody binds to Rhesus CKM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
Product OverviewMouse Anti-Rhesus CKM Antibody is a mouse antibody against CKM. It can be used for CKM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCreatine Kinase, M-Type; Creatine Kinase, Muscle; Creatine Kinase M Chain; EC 2.7.3.2; CKMM; M-CK; Creatine Kinase M-Type; EC 2.7.3
UniProt IDG7NMC0
Protein RefseqThe length of the protein is 381 amino acids long.
The sequence is show below: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry