AibGenesis™ Mouse Anti-CMTM2 Antibody (CBMOAB-39468FYA)


Cat: CBMOAB-39468FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39468FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO39468FYA 100 µg
Inquiry
MO-AB-10388R Monoclonal Cattle (Bos taurus) WB, ELISA MO10388R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO39468FYA
SpecificityThis antibody binds to Rhesus CMTM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. (From NCBI)
Product OverviewMouse Anti-Rhesus CMTM2 Antibody is a mouse antibody against CMTM2. It can be used for CMTM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMTM2
UniProt IDF6RFF0
Protein RefseqThe length of the protein is 173 amino acids long.
The sequence is show below: MAPKAAKGAKTEPAPPPAGAKPQEDKKDDKEPLDKPQKLVQPKHEVGTRKGCRRYRWELKDSNKEFWLLGHAEVKILSLDLFNDLFACAFLVGAVVFAVRSRRSMHLHYLLAVILVGVAGVFALIDMCLQRNNFRGKRAKKHKLISPPGKEKEPQQGKGPEPAKPPEPAKGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry