AibGenesis™ Mouse Anti-CNTNAP3 Antibody (CBMOAB-39567FYA)


Cat: CBMOAB-39567FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39567FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO39567FYA 100 µg
MO-AB-10449R Monoclonal Cattle (Bos taurus) WB, ELISA MO10449R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO39567FYA
SpecificityThis antibody binds to Rhesus CNTNAP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CNTNAP3 Antibody is a mouse antibody against CNTNAP3. It can be used for CNTNAP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesContactin-associated protein-like 3; CNTNAP3
UniProt IDH9FE90
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: LDLNFEISFGGVPTPGRARAFTRKSFHGCLENLYYNGVDVAELAKKHKPQILMMGNVSFSCPQPQTVPVTFLSSRSYLALPANSGEDKVSVTFQFRTWNRAGHLLFGELQRGSGSFVLFLKDGKLKLSVFQPGQSPKNVTAGAGLNDGHWHSVSLSAKWSHMNVVVDDDTAVQPLVAALIDSGDTYYFGGCLDNSSGSGCKSPVGGFQGCLRLITIGDKAVDPISVQQGALGRFRDLQIDSCGITDRCLPSYC.
For Research Use Only | Not For Clinical Use.
Online Inquiry