Mouse Anti-Rhesus COQ7 Antibody (MO-AB-03555W)


Cat: MO-AB-03555W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03555W
SpecificityThis antibody binds to Rhesus COQ7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOQ7 (Coenzyme Q7, Hydroxylase) is a Protein Coding gene. Diseases associated with COQ7 include Coenzyme Q10 Deficiency, Primary, 8. Among its related pathways are Ubiquinol biosynthesis and Metabolism.
Product OverviewMouse Anti-Rhesus COQ7 Antibody is a mouse antibody against COQ7. It can be used for COQ7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoenzyme Q7, Hydroxylase; Ubiquinone Biosynthesis Monooxygenase COQ7; Timing Protein Clk-1 Homolog; DMQ Hydroxylase; 5-Demethoxyubiquinone Hydroxylase, Mitochondrial; Ubiquinone Biosynthesis Protein COQ7 Homolog; Coenzyme Q Biosynthesis Protein 7 Homolog; Coenzyme Q7 Homolog, Ubiquinone (Yeast); COQ7 Coenzyme Q, 7 Homolog Ubiquinone; Coenzyme Q, 7 (Rat, Yeast) Homolog
UniProt IDG7NPR9
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MSCASAAAAPCLWRLRPGARRSLSAYGRRIIVRFRSSGMTLDNINRAVVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFSELMVTFRVRPTVLMPFWNVLGFALGAGTALLGKEGAMACTVVVEESIAHHYNNQIRKLMEEDPEKYKELLQVIKKFRDEELEHHDTGLEHDAELAPAYAVLKSVIQAGCKVAIYLSERL.
For Research Use Only | Not For Clinical Use.
Online Inquiry