Mouse Anti-Rhesus CSNK1A1 Antibody (CBMOAB-39992FYA)
Cat: CBMOAB-39992FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO39992FYA |
Specificity | This antibody binds to Rhesus CSNK1A1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CSNK1A1 (Casein Kinase 1 Alpha 1) is a Protein Coding gene. Among its related pathways are S33 mutants of beta-catenin arent phosphorylated and NFAT and Cardiac Hypertrophy. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CSNK1A1L. |
Product Overview | Mouse Anti-Rhesus CSNK1A1 Antibody is a mouse antibody against CSNK1A1. It can be used for CSNK1A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Casein kinase 1, alpha 1; CSNK1A1 |
UniProt ID | Q3YAQ7 |
Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: LNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF. |
See other products for " CSNK1A1 "
MO-AB-53625W | Mouse Anti-Marmoset CSNK1A1 Antibody (MO-AB-53625W) |
MO-AB-01452Y | Mouse Anti-Chicken CSNK1A1 Antibody (MO-AB-01452Y) |
CBMOAB-71980FYA | Mouse Anti-Zebrafish csnk1a1 Antibody (CBMOAB-71980FYA) |
MO-AB-02691H | Mouse Anti-Frog csnk1a1 Antibody (MO-AB-02691H) |
MO-AB-10838R | Mouse Anti-Cattle CSNK1A1 Antibody (MO-AB-10838R) |
MO-AB-13844W | Mouse Anti-Chimpanzee CSNK1A1 Antibody (MO-AB-13844W) |
MO-AB-07722Y | Mouse Anti-Rabbit CSNK1A1 Antibody (MO-AB-07722Y) |
MO-AB-24916R | Mouse Anti-Pig CSNK1A1 Antibody (MO-AB-24916R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry