AibGenesis™ Mouse Anti-CYB5RL Antibody (CBMOAB-40199FYA)


Cat: CBMOAB-40199FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40199FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Marmoset WB, ELISA MO40199FYA 100 µg
MO-AB-03583W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03583W 100 µg
MO-AB-08755W Monoclonal Cat (Felis catus) WB, ELISA MO08755W 100 µg
MO-AB-11005R Monoclonal Cattle (Bos taurus) WB, ELISA MO11005R 100 µg
MO-AB-20450W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20450W 100 µg
MO-AB-29980W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29980W 100 µg
MO-AB-44250W Monoclonal Horse (Equus caballus) WB, ELISA MO44250W 100 µg
MO-AB-53801W Monoclonal Marmoset WB, ELISA MO53801W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Marmoset
CloneMO40199FYA
SpecificityThis antibody binds to Rhesus CYB5RL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYB5RL Antibody is a mouse antibody against CYB5RL. It can be used for CYB5RL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYB5RL
UniProt IDF7DD80
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: SGLCWQHVPVMSPCVCFQCYQMGLMSRYVESWRAGDTAFWRGPFGDFFYKPNQYGELLMLAAGTGLAPMVPILQSITDNEDDETFVTLVGCFKTFESIYLKTFLQEQACFWNVRTFFVLSQESSSEQLPWSYQEKTRFGRLGQDLIKELVSCCRRKPFALVCGSAEFNKDIARCLLCAGLTEDSYFLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry