Mouse Anti-Rhesus CYP27C1 Antibody (MO-AB-03585W)


Cat: MO-AB-03585W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03585W
SpecificityThis antibody binds to Rhesus CYP27C1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP27C1 (Cytochrome P450 Family 27 Subfamily C Member 1) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP27B1.
Product OverviewMouse Anti-Rhesus CYP27C1 Antibody is a mouse antibody against CYP27C1. It can be used for CYP27C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 Family 27 Subfamily C Member 1; Cytochrome P450, Family 27, Subfamily C, Polypeptide 1; All-Trans Retinol 3,4-Desaturase; EC 1.14.19.-
UniProt IDG7NB44
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRLGCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRDIQYHTDRGRRASGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTKAVHAKTHGLLTPGGPIHVRFVNRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry