Mouse Anti-Rhesus CYP2A6 Antibody (CBMOAB-40243FYA)


Cat: CBMOAB-40243FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40243FYA
SpecificityThis antibody binds to Rhesus CYP2A6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2A6 (Cytochrome P450 Family 2 Subfamily A Member 6) is a Protein Coding gene. Diseases associated with CYP2A6 include Tobacco Addiction and Coumarin Resistance. Among its related pathways are superpathway of steroid hormone biosynthesis and superpathway of tryptophan utilization. Gene Ontology (GO) annotations related to this gene include enzyme binding and heme binding. An important paralog of this gene is CYP2A7.
Product OverviewMouse Anti-Rhesus CYP2A6 Antibody is a mouse antibody against CYP2A6. It can be used for CYP2A6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450, family 2, subfamily A, polypeptide 6; CYP2A6
UniProt IDB6EY70
Protein RefseqThe length of the protein is 59 amino acids long.
The sequence is show below: LYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNRHTLDPNSPRDFIDSFLIRMQE.
See other products for " CYP2A6 "
MO-AB-25037RMouse Anti-Pig CYP2A6 Antibody (MO-AB-25037R)
MO-AB-11046RMouse Anti-Cattle CYP2A6 Antibody (MO-AB-11046R)
MO-AB-14805YMouse Anti-Sheep CYP2A6 Antibody (MO-AB-14805Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry