Mouse Anti-Rhesus CYP2C8 Antibody (CBMOAB-40250FYA)


Cat: CBMOAB-40250FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40250FYA
SpecificityThis antibody binds to Rhesus CYP2C8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2C8 (Cytochrome P450 Family 2 Subfamily C Member 8) is a Protein Coding gene. Diseases associated with CYP2C8 include Osteonecrosis Of The Jaw and Osteonecrosis. Among its related pathways are Statin Pathway - Generalized, Pharmacokinetics and Drug metabolism - cytochrome P450. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP2C19.
Product OverviewMouse Anti-Rhesus CYP2C8 Antibody is a mouse antibody against CYP2C8. It can be used for CYP2C8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP2C8
UniProt IDF7H678
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MDPFVVLVLCLSFVLLFSLWRQSSGRRKLPPGPTPLPIIGNILQIDVKDIGKSFSNFSKVYGPVFTVYFGMNPVVVLHGYETVKEALIDNAEEFSGRGILPISERITNGLGIISSNGKRWKETRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDENFLTLMKRFTVNFRILTSPWIQVCNNFPLLIDCFPGTHNKLLKNVALTKSYIRKKVKEHQATLDVNNPRDFIDCFLIKMEQEKDNQQSEFTIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVIHEIQRYIDLVPTGVPHAVTTDIKFRNYLIPKSFDNKIMLAA.
See other products for " CYP2C8 "
For Research Use Only | Not For Clinical Use.
Online Inquiry