Mouse Anti-CYP2E1 Antibody (CBMOAB-40262FYA)
Cat: CBMOAB-40262FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40262FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO40262FYA | 100 µg | ||
| MO-AB-02805H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02805C | 100 µg | ||
| MO-AB-07796W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07796W | 100 µg | ||
| MO-AB-07801Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07801Y | 100 µg | ||
| MO-AB-11053R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11053R | 100 µg | ||
| MO-AB-14810Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14810Y | 100 µg | ||
| MO-AB-25050R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25050R | 100 µg | ||
| MO-AB-25247H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25247C | 100 µg | ||
| MO-AB-30017W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30017W | 100 µg | ||
| MO-AB-53837W | Monoclonal | Marmoset | WB, ELISA | MO53837W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO40262FYA |
| Specificity | This antibody binds to Rhesus CYP2E1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus CYP2E1 Antibody is a mouse antibody against CYP2E1. It can be used for CYP2E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome P450 2E1; CYP2E1 |
| UniProt ID | H9F3W9 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: LDESGKFKYSDYFKPFSAGKRVCAGEGLARMELFLLLSAILQHFNLKPLVDPKDIDISPVNIGFGCIPPRFKLCVIPRS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry