Mouse Anti-Rhesus CYP4F3 Antibody (CBMOAB-40305FYA)


Cat: CBMOAB-40305FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40305FYA
SpecificityThis antibody binds to Rhesus CYP4F3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP4F3 (Cytochrome P450 Family 4 Subfamily F Member 3) is a Protein Coding gene. Diseases associated with CYP4F3 include Inflammatory Bowel Disease 6. Among its related pathways are Arachidonic acid metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP4F2.
Product OverviewMouse Anti-Rhesus CYP4F3 Antibody is a mouse antibody against CYP4F3. It can be used for CYP4F3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP4F3
UniProt IDF7GYF6
Protein RefseqThe length of the protein is 520 amino acids long.
The sequence is show below: MPQLSLSSLGLGPVAVSPWLLLLLIGVSWLLARVLAWTYTFYDNCRRLRCFPQPPKRNWFWGHLGLVTPTEQGMRVLTQLVATYPQGFKVWMGPIIPVIRFCHPNLIRSVINASAAIVPKDKLFYSFLKPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVAKRHQQFFLYIDFLYYLTHDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVEDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAISRCCTQDIVLPDGRVIPKGVICHISVLGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry