AibGenesis™ Mouse Anti-CYTL1 Antibody (CBMOAB-40339FYA)


Cat: CBMOAB-40339FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40339FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO40339FYA 100 µg
MO-AB-02841H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02841C 100 µg
MO-AB-22762W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22762W 100 µg
MO-AB-25261H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25261C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO40339FYA
SpecificityThis antibody binds to Rhesus CYTL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYTL1 Antibody is a mouse antibody against CYTL1. It can be used for CYTL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYTL1
UniProt IDF7CJ05
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: MRTPGPLPVLLLLLAGIPAARPTPPTCYSRMRALSQEITRDFQLLQSSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPQCWKAAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDHQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry