Mouse Anti-Rhesus DCAF12L2 Antibody (CBMOAB-40433FYA)


Cat: CBMOAB-40433FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40433FYA
SpecificityThis antibody binds to Rhesus DCAF12L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. (From NCBI)
Product OverviewMouse Anti-Rhesus DCAF12L2 Antibody is a mouse antibody against DCAF12L2. It can be used for DCAF12L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDCAF12L2
UniProt IDF6SM10
Protein RefseqThe length of the protein is 463 amino acids long.
The sequence is show below: MAQQQTGSRKRKAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVGARGPAGLQGFEGELRGYAVQRLPELLTERQLDLGTLNKVFASQWLNARQVVCGTKCNTLFVVDVQSGHITRIPLMRDKEAGLAQAQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPTLDPLCLGDRHGHKDWIFAVAWLSDTVAVSGSRDGTVALWRMDPDMFNGSIAWHSEVGLPVYAHIRPKDVEAIPRASTNPSNRKVRALAFSGKNQELGAVSLDGYFHLWKARSTLSRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHVSFLDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASASLDSTPGPAGRKLKLACGRGWLNQDDVWVNYFGGMEEFPNALYTHCYNWPEMKLFVAGGPLPSGLHGNYAGLWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry