AibGenesis™ Mouse Anti-DDTL Antibody (CBMOAB-40546FYA)


Cat: CBMOAB-40546FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40546FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus) WB, ELISA MO40546FYA 100 µg
MO-AB-01566Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01566Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus)
CloneMO40546FYA
SpecificityThis antibody binds to Rhesus DDTL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DDTL Antibody is a mouse antibody against DDTL. It can be used for DDTL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDDTL
UniProt IDH9H306
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: IPFLELDRNLPNNRVPAGLEKRLCAAATSILGKPADRGKVTVRTGLTMALSGSTKPCAQPSVSSICVVEDNRSHSAHFEFLTKELALGQDWFPMGLSPSPATHGGPRCPGGITEGKKSCLNEEALIYFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry