AibGenesis™ Mouse Anti-DENND2C Antibody (CBMOAB-40635FYA)


Cat: CBMOAB-40635FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40635FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40635FYA 100 µg
CBMOAB-73302FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73302FYA 100 µg
MO-AB-54096W Monoclonal Marmoset WB, ELISA MO54096W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO40635FYA
SpecificityThis antibody binds to Rhesus DENND2C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DENND2C Antibody is a mouse antibody against DENND2C. It can be used for DENND2C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDENND2C
UniProt IDF7H9T8
Protein RefseqThe length of the protein is 471 amino acids long.
The sequence is show below: EDTKSHDQSENENKKQEYDDTHFFKNESESNWVCSRVKEIESCKEDVLDPETSLPPGNFYTSQILWKKIEALPPDKLLNLALEHCDSSEKELNFRVLDSSYGITKSLENIYSEPEGQECGPSINPLPKPRRTFRYLSESGVMPYKERNCDKKYCENNSCAQSSLASSQEPEPKKYGGKIRGRSKRKSFEFEDIQHFRNRNTQTIHEELGKNSGSALYYTQSEDNIYEDIIYPTKENPYEDIPVQPLPMWRSPSAWKLPPAKSAFKAPKLPPKPQFLHRKTMEVKNSQAYLRSKLTKDTTLPVTLTEWKLFRAGEVANRKMKNLPRLVLKIDDIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQQSSKRNPHYQTLERDLIELQEQQLFELFVVVSLQKKPSGISYIPQVIQQFPGKDDHGYKQSKDTEERLKVIPKFCFPDSKDWMPTSELK.
For Research Use Only | Not For Clinical Use.
Online Inquiry