Mouse Anti-Rhesus DGCR6 Antibody (CBMOAB-40695FYA)


Cat: CBMOAB-40695FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40695FYA
SpecificityThis antibody binds to Rhesus DGCR6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia.
Product OverviewMouse Anti-Rhesus DGCR6 Antibody is a mouse antibody against DGCR6. It can be used for DGCR6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein DGCR6; DGCR6
UniProt IDI2CYB8
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDRKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGKAALGLGGPWQPPAAQCDQKGSPVPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry