Mouse Anti-Rhesus DHODH Antibody (CBMOAB-40728FYA)


Cat: CBMOAB-40728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40728FYA
SpecificityThis antibody binds to Rhesus DHODH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Product OverviewMouse Anti-Rhesus DHODH Antibody is a mouse antibody against DHODH. It can be used for DHODH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDihydroorotate dehydrogenase (Quinone), mitochondrial; DHODH
UniProt IDI0FPN7
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MAWRHLKKRARDAVVILGGGGLLFASYLMATGDERFYAEHLMPALQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQARLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLQGAHRPAVLVKIAPDLTAQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGRVKRELEALLKEQGFGRVTDAIGADHRR.
See other products for " DHODH "
MO-AB-44423WMouse Anti-Horse DHODH Antibody (MO-AB-44423W)
MO-AB-30152WMouse Anti-Dog DHODH Antibody (MO-AB-30152W)
MO-AB-11415RMouse Anti-Cattle DHODH Antibody (MO-AB-11415R)
MO-AB-08144WMouse Anti-Cat DHODH Antibody (MO-AB-08144W)
MO-AB-14441WMouse Anti-Chimpanzee DHODH Antibody (MO-AB-14441W)
CBMOAB-73444FYAMouse Anti-Zebrafish dhodh Antibody (CBMOAB-73444FYA)
MO-AB-07900YMouse Anti-Rabbit DHODH Antibody (MO-AB-07900Y)
MO-AB-41567WMouse Anti-Guinea pig DHODH Antibody (MO-AB-41567W)
MO-AB-54171WMouse Anti-Marmoset DHODH Antibody (MO-AB-54171W)
MO-AB-02972HMouse Anti-Frog dhodh Antibody (MO-AB-02972H)
For Research Use Only | Not For Clinical Use.
Online Inquiry