AibGenesis™ Mouse Anti-DMRTC2 Antibody (CBMOAB-40914FYA)


Cat: CBMOAB-40914FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40914FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO40914FYA 100 µg
MO-AB-11508R Monoclonal Cattle (Bos taurus) WB, ELISA MO11508R 100 µg
MO-AB-16577W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16577W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO40914FYA
SpecificityThis antibody binds to Rhesus DMRTC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DMRTC2 Antibody is a mouse antibody against DMRTC2. It can be used for DMRTC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDMRTC2
UniProt IDF6YWL8
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MEPSDMPAGYHCPSDSAPQNETRDPQGTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTARPQVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSRPPEALPLSWTPVPPGPWVPGHWLPPGLSMPPPVVCRLLYQEPALSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLSGEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASRLARTSAPSERQLQQEAAEALVGLKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRLGSISLLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry