Mouse Anti-Rhesus DSCAM Antibody (CBMOAB-41218FYA)


Cat: CBMOAB-41218FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO41218FYA
SpecificityThis antibody binds to Rhesus DSCAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the immunoglobulin superfamily of cell adhesion molecules (Ig-CAMs), and is involved in human central and peripheral nervous system development. This gene is a candidate for Down syndrome and congenital heart disease (DSCHD). A gene encoding a similar Ig-CAM protein is located on chromosome 11. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Rhesus DSCAM Antibody is a mouse antibody against DSCAM. It can be used for DSCAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDown syndrome cell adhesion molecule isoform CHD2-42; DSCAM
UniProt IDH9FK66
Protein RefseqThe length of the protein is 108 amino acids long.
The sequence is show below: PDYRWLKDNMPLELSGRFQKTVTGLLIENIRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCTVTGTEDQELSWYRNGEILNPGKNVR.
For Research Use Only | Not For Clinical Use.
Online Inquiry