AibGenesis™ Mouse Anti-DUSP15 Antibody (CBMOAB-41310FYA)
Cat: CBMOAB-41310FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41310FYA | Monoclonal | Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO41310FYA | 100 µg | ||
| MO-AB-25504H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25504C | 100 µg | ||
| MO-AB-54582W | Monoclonal | Marmoset | WB, ELISA | MO54582W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO41310FYA |
| Specificity | This antibody binds to Rhesus DUSP15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus DUSP15 Antibody is a mouse antibody against DUSP15. It can be used for DUSP15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | DUSP15 |
| UniProt ID | F6SXX8 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: MGNGMTKMPKTWISWAGIRSHTSSLSMSHPSLCCRISPTFASRWLIPLRYPSKSTSKNVSTSSTAAALMGGTALCT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry