AibGenesis™ Mouse Anti-DUSP28 Antibody (CBMOAB-41317FYA)


Cat: CBMOAB-41317FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41317FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO41317FYA 100 µg
MO-AB-18088W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18088W 100 µg
MO-AB-25512H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25512C 100 µg
MO-AB-54591W Monoclonal Marmoset WB, ELISA MO54591W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO41317FYA
SpecificityThis antibody binds to Rhesus DUSP28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DUSP28 Antibody is a mouse antibody against DUSP28. It can be used for DUSP28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDUSP28
UniProt IDF6VPS4
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: MEQGDAGRRVTALPVPPPFVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRGGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAQAFQMVKSARPVAEPNLGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry