Mouse Anti-Rhesus DUSP4 Antibody (MO-AB-01957W)
Cat: MO-AB-01957W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO01957W |
Specificity | This antibody binds to Rhesus DUSP4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine / threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK / ERK, SAPK / JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. |
Product Overview | Mouse Anti-Rhesus DUSP4 Antibody is a mouse antibody against DUSP4. It can be used for DUSP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dual specificity protein phosphatase 4 isoform 1; DUSP4 |
UniProt ID | H9FH19 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: GPVEILPFLYLGSAYHAARRDMLDTLGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRG. |
See other products for " DUSP4 "
MO-AB-07935Y | Mouse Anti-Rabbit DUSP4 Antibody (MO-AB-07935Y) |
CBMOAB-41318FYA | Mouse Anti-Rhesus DUSP4 Antibody (CBMOAB-41318FYA) |
MO-AB-33049H | Mouse Anti-Nile tilapia dusp4 Antibody (MO-AB-33049H) |
MO-AB-01665Y | Mouse Anti-Chicken DUSP4 Antibody (MO-AB-01665Y) |
MO-AB-54594W | Mouse Anti-Marmoset DUSP4 Antibody (MO-AB-54594W) |
MO-AB-26393W | Mouse Anti-Chimpanzee DUSP4 Antibody (MO-AB-26393W) |
MO-AB-09336W | Mouse Anti-Cat DUSP4 Antibody (MO-AB-09336W) |
MO-AB-34695W | Mouse Anti-Ferret DUSP4 Antibody (MO-AB-34695W) |
CBMOAB-63932FYA | Mouse Anti-Zebrafish dusp4 Antibody (CBMOAB-63932FYA) |
MO-AB-30627W | Mouse Anti-Dog DUSP4 Antibody (MO-AB-30627W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry