Mouse Anti-Rhesus DUSP4 Antibody (MO-AB-01957W)


Cat: MO-AB-01957W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01957W
SpecificityThis antibody binds to Rhesus DUSP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine / threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK / ERK, SAPK / JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported.
Product OverviewMouse Anti-Rhesus DUSP4 Antibody is a mouse antibody against DUSP4. It can be used for DUSP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDual specificity protein phosphatase 4 isoform 1; DUSP4
UniProt IDH9FH19
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: GPVEILPFLYLGSAYHAARRDMLDTLGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry