AibGenesis™ Mouse Anti-EGR4 Antibody (CBMOAB-41550FYA)


Cat: CBMOAB-41550FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41550FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO41550FYA 100 µg
MO-AB-03222H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03222C 100 µg
MO-AB-11883R Monoclonal Cattle (Bos taurus) WB, ELISA MO11883R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO41550FYA
SpecificityThis antibody binds to Rhesus EGR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EGR4 Antibody is a mouse antibody against EGR4. It can be used for EGR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEarly growth response protein 4; EGR4
UniProt IDH9FFK6
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: QLSPLGLRSAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPPAKVRRKGRRGGKCSTRCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHK.
For Research Use Only | Not For Clinical Use.
Online Inquiry