AibGenesis™ Mouse Anti-EIF4E1B Antibody (CBMOAB-41628FYA)


Cat: CBMOAB-41628FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41628FYA Monoclonal Rhesus (Macaca mulatta), Horse (Equus caballus), Zebrafish (Danio rerio) WB, ELISA MO41628FYA 100 µg
CBMOAB-74741FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74741FYA 100 µg
MO-AB-44552W Monoclonal Horse (Equus caballus) WB, ELISA MO44552W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Horse (Equus caballus), Zebrafish (Danio rerio)
CloneMO41628FYA
SpecificityThis antibody binds to Rhesus EIF4E1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EIF4E1B Antibody is a mouse antibody against EIF4E1B. It can be used for EIF4E1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEIF4E1B
UniProt IDF7H3T0
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: HPLQNRWALWFFKNDRSRAWQDNLHLVTKVDSVEDFWALYSHIQLASKLSSGCDYALFKDGIEPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHIGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry