Mouse Anti-Rhesus ELMOD2 Antibody (CBMOAB-41684FYA)


Cat: CBMOAB-41684FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO41684FYA
SpecificityThis antibody binds to Rhesus ELMOD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis.
Product OverviewMouse Anti-Rhesus ELMOD2 Antibody is a mouse antibody against ELMOD2. It can be used for ELMOD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELMO domain-containing protein 2; ELMOD2
UniProt IDH9F688
Protein RefseqThe length of the protein is 89 amino acids long.
The sequence is show below: AIVGINLTEMAYSLLKSEALKFHLYNFVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDCNVALTLKV.
See other products for " ELMOD2 "
MO-AB-11973RMouse Anti-Cattle ELMOD2 Antibody (MO-AB-11973R)
CBMOAB-74870FYAMouse Anti-Zebrafish elmod2 Antibody (CBMOAB-74870FYA)
MO-AB-17148WMouse Anti-Chimpanzee ELMOD2 Antibody (MO-AB-17148W)
MO-AB-03265HMouse Anti-Frog elmod2 Antibody (MO-AB-03265H)
For Research Use Only | Not For Clinical Use.
Online Inquiry