AibGenesis™ Mouse Anti-ENY2 Antibody (CBMOAB-41824FYA)
Cat: CBMOAB-41824FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41824FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Marmoset, O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) | WB, ELISA | MO41824FYA | 100 µg | ||
| CBMOAB-75080FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO75080FYA | 100 µg | ||
| MO-AB-06469Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06469Y | 100 µg | ||
| MO-AB-09340W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09340W | 100 µg | ||
| MO-AB-11330Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11330Y | 100 µg | ||
| MO-AB-12057R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12057R | 100 µg | ||
| MO-AB-25655H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25655C | 100 µg | ||
| MO-AB-26419W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26419W | 100 µg | ||
| MO-AB-34728W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34728W | 100 µg | ||
| MO-AB-38549W | Monoclonal | Gorilla | WB, ELISA | MO38549W | 100 µg | ||
| MO-AB-43129W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43129W | 100 µg | ||
| MO-AB-44598W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44598W | 100 µg | ||
| MO-AB-54983W | Monoclonal | Marmoset | WB, ELISA | MO54983W | 100 µg | ||
| MO-NAB-00185W | Monoclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | NW0042 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Marmoset, O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) |
| Clone | MO41824FYA |
| Specificity | This antibody binds to Rhesus ENY2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus ENY2 Antibody is a mouse antibody against ENY2. It can be used for ENY2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Transcription and mRNA export factor ENY2; Enhancer of yellow 2 transcription factor homolog; ENY2 |
| UniProt ID | H9EQK1 |
| Protein Refseq | The length of the protein is 96 amino acids long. The sequence is show below: MNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry