AibGenesis™ Mouse Anti-ERAL1 Antibody (CBMOAB-41908FYA)


Cat: CBMOAB-41908FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41908FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO41908FYA 100 µg
CBMOAB-75230FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75230FYA 100 µg
MO-AB-01783Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01783Y 100 µg
MO-AB-10938W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10938W 100 µg
MO-AB-12097R Monoclonal Cattle (Bos taurus) WB, ELISA MO12097R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO41908FYA
SpecificityThis antibody binds to Rhesus ERAL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of this gene has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ERAL1 Antibody is a mouse antibody against ERAL1. It can be used for ERAL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTPase Era, mitochondrial; ERAL1
UniProt IDH9FSU7
Protein RefseqThe length of the protein is 437 amino acids long.
The sequence is show below: MAAPSWRGAGLVQEVLRVWQVGPHVARERVIPFSSPLSFQRRCVSCVAGSAFSGPRLASASRNYGQGSALDHFLGFSQRDSSVTSCVPAVSMHRDEQDLLLVHHPDMPENPRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSKKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLDDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKFSQIPSVLVMNKIDCLKRKSVLLELTAALTEGVVNGKKLEMRQAFHSQPGTRCPSPAVKDPHTLSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICTNVIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYMKLLIGPKGHVISQIAQEAGRDLMNIFLCDVDIHLSVKLLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry