AibGenesis™ Mouse Anti-ERGIC1 Antibody (CBMOAB-41956FYA)


Cat: CBMOAB-41956FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41956FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41956FYA 100 µg
CBMOAB-75293FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75293FYA 100 µg
MO-AB-12116R Monoclonal Cattle (Bos taurus) WB, ELISA MO12116R 100 µg
MO-AB-21387W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21387W 100 µg
MO-AB-55083W Monoclonal Marmoset WB, ELISA MO55083W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO41956FYA
SpecificityThis antibody binds to Rhesus ERGIC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. (From NCBI)
Product OverviewMouse Anti-Rhesus ERGIC1 Antibody is a mouse antibody against ERGIC1. It can be used for ERGIC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesERGIC1
UniProt IDF6V723
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: VNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVRKPCLSPFYLLPIPAVSLLPGNWLWRHSLDLTPTQPPASEGSCPLAWPTLLRIWMVQASCSFKPLMAGSGRSYSSPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry