AibGenesis™ Mouse Anti-FAAP24 Antibody (CBMOAB-60846FYC)


Cat: CBMOAB-60846FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60846FYC Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO60846FYC 100 µg
MO-AB-03431H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03431C 100 µg
MO-AB-12237R Monoclonal Cattle (Bos taurus) WB, ELISA MO12237R 100 µg
MO-AB-25699H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25699C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO60846FYC
SpecificityThis antibody binds to Rhesus FAAP24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAAP24 Antibody is a mouse antibody against FAAP24. It can be used for FAAP24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFanconi anemia-associated protein of 24 kDa; FAAP24
UniProt IDG7NLG3
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MEKKPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCVLYVTEADLVAGNGYRKRLVRVRNSGNLQGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLRKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIRELEQVVGQAVAKQIHAFFTQPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry