AibGenesis™ Mouse Anti-FAIM2 Antibody (CBMOAB-42168FYA)


Cat: CBMOAB-42168FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42168FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO42168FYA 100 µg
MO-AB-03446H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03446C 100 µg
MO-AB-12268R Monoclonal Cattle (Bos taurus) WB, ELISA MO12268R 100 µg
MO-AB-25603W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25603W 100 µg
MO-AB-55234W Monoclonal Marmoset WB, ELISA MO55234W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO42168FYA
SpecificityThis antibody binds to Rhesus FAIM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAIM2 Antibody is a mouse antibody against FAIM2. It can be used for FAIM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFas apoptotic inhibitory molecule 2; FAIM2
UniProt IDI2CTG2
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MTQGKLSVANKAPGTEGQQQVHEKKETPAVPSAPPSYEEATSGEGMKAGVFSPAPTAVPLHPSWAYVDPSSSSSYDSGFPTGDHELFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPAWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry