AibGenesis™ Mouse Anti-FAM122C Antibody (CBMOAB-42224FYA)


Cat: CBMOAB-42224FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42224FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO42224FYA 100 µg
MO-AB-03452H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03452C 100 µg
MO-AB-25725H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25725C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO42224FYA
SpecificityThis antibody binds to Rhesus FAM122C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM122C Antibody is a mouse antibody against FAM122C. It can be used for FAM122C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM122C
UniProt IDF7HFJ3
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: TSNRSLEEAMNLITRETMYEWKIQTEIQISQSWEEGLKLLTQNDNGSQKSSSLKCIDLTPVSSMASSIKKTGKTCVSCTGSPSSHIPSPTQQYIIRSQNPTNIIRPSILGPLKRKGEMAFQYQPKRIFQGTTNILSSDTSQLSENNGW.
For Research Use Only | Not For Clinical Use.
Online Inquiry